Lineage for d1lbxa_ (1lbx A:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1055431Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 1055432Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 1055433Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 1055442Protein Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase [56665] (4 species)
  7. 1055443Species Archaeoglobus fulgidus [TaxId:2234] [75608] (5 PDB entries)
  8. 1055452Domain d1lbxa_: 1lbx A: [73817]
    complexed with ca, ipd

Details for d1lbxa_

PDB Entry: 1lbx (more details), 2.4 Å

PDB Description: Crystal Structure of a ternary complex of dual activity FBPase/IMPase (AF2372) from Archaeoglobus fulgidus with Calcium ions and D-myo-Inositol-1-Phosphate
PDB Compounds: (A:) fructose 1,6-bisphosphatase/inositol monophosphatase

SCOPe Domain Sequences for d1lbxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbxa_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeoglobus fulgidus [TaxId: 2234]}
mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
rvtvvteesgvlgegdvfvaldpldgtfnatrgipvysvslcfsysdklkdaffgyvynl
atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfkrmrifgsaatelcffa
dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
eklhpkllelik

SCOPe Domain Coordinates for d1lbxa_:

Click to download the PDB-style file with coordinates for d1lbxa_.
(The format of our PDB-style files is described here.)

Timeline for d1lbxa_: