SCOPe 2.01: Domain d1lb8b_: 1lb8 B:

Lineage for d1lb8b_ (1lb8 B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (101 PDB entries)

8. Domain d1lb8b_: 1lb8 B: [73801]
   complexed with amq; mutant

Details for d1lb8b_

PDB Entry: 1lb8, 2.3 Å

PDB Description: crystal structure of the non-desensitizing glur2 ligand binding core mutant (s1s2j-l483y) in complex with ampa at 2.3 resolution

PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d1lb8b_:

Sequence; same for both SEQRES and ATOM records:

>d1lb8b_ c.94.1.1 (B:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltityvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgecg

Timeline for d1lb8b_:

• d1lb8b_ first appeared in SCOP 1.61
  
• d1lb8b_ appears in SCOP 1.75
  
• d1lb8b_ appears in SCOPe 2.02
  
• d1lb8b_ appears in the current release, SCOPe 2.08