Class i: Low resolution protein structures [58117] (18 folds) |
Fold i.8: RNA polymerase [58180] (1 superfamily) |
Superfamily i.8.1: RNA polymerase [58181] (1 family) |
Family i.8.1.1: RNA polymerase [58182] (1 protein) |
Protein DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits [58183] (1 species) |
Species Thermus aquaticus [TaxId:271] [58184] (3 PDB entries) |
Domain d1l9ue_: 1l9u E: [73752] |
PDB Entry: 1l9u (more details), 4 Å
SCOP Domain Sequences for d1l9ue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9ue_ i.8.1.1 (E:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus} aepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpnav twamkelltgrlffgenlvpedrlqkemerly
Timeline for d1l9ue_: