Lineage for d1l9aa_ (1l9a A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.201: SRP19 [69694] (1 superfamily) Superfamily d.201.1: SRP19 [69695] (1 family) 
Family d.201.1.1: SRP19 [69696] (1 protein) Protein SRP19 [69697] (3 species) 
Species Archaeon Methanococcus jannaschii [TaxId:2190] [75417] (2 PDB entries) 
Domain d1l9aa_: 1l9a A: [73710]
Details for d1l9aa_
PDB Entry: 1l9a (more details), 2.9 Å
PDB Description: crystal structure of srp19 in complex with the s domain of signal recognition particle rna
SCOP Domain Sequences for d1l9aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9aa_ d.201.1.1 (A:) SRP19 {Archaeon Methanococcus jannaschii}
miiwpsyidkkksrregrkvpeelaiekpslkdiekalkklglepkiyrdkryprqhwei
agrvevdykgnklcllkeiakiikgkn
SCOP Domain Coordinates for d1l9aa_:
Click to download the PDB-style file with coordinates for d1l9aa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l9aa_:
- d1l9aa_ is new in SCOP 1.61
- d1l9aa_ appears in SCOP 1.63
- d1l9aa_ appears in the current release, SCOPe 2.08
View in 3D