Lineage for d1l9aa_ (1l9a A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 199732Fold d.201: SRP19 [69694] (1 superfamily)
  4. 199733Superfamily d.201.1: SRP19 [69695] (1 family) (S)
  5. 199734Family d.201.1.1: SRP19 [69696] (1 protein)
  6. 199735Protein SRP19 [69697] (3 species)
  7. 199739Species Archaeon Methanococcus jannaschii [TaxId:2190] [75417] (2 PDB entries)
  8. 199741Domain d1l9aa_: 1l9a A: [73710]

Details for d1l9aa_

PDB Entry: 1l9a (more details), 2.9 Å

PDB Description: crystal structure of srp19 in complex with the s domain of signal recognition particle rna

SCOP Domain Sequences for d1l9aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9aa_ d.201.1.1 (A:) SRP19 {Archaeon Methanococcus jannaschii}
miiwpsyidkkksrregrkvpeelaiekpslkdiekalkklglepkiyrdkryprqhwei
agrvevdykgnklcllkeiakiikgkn

SCOP Domain Coordinates for d1l9aa_:

Click to download the PDB-style file with coordinates for d1l9aa_.
(The format of our PDB-style files is described here.)

Timeline for d1l9aa_: