Lineage for d1l8ya_ (1l8y A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725579Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 1725580Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 1725581Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 1725613Protein Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) [68982] (2 species)
    Contains 6 HMG-box domains
  7. 1725614Species Human (Homo sapiens) [TaxId:9606] [68983] (3 PDB entries)
  8. 1725616Domain d1l8ya_: 1l8y A: [73708]
    HMG box 5

Details for d1l8ya_

PDB Entry: 1l8y (more details)

PDB Description: solution structure of hmg box 5 in human upstream binding factor
PDB Compounds: (A:) Upstream binding factor 1

SCOPe Domain Sequences for d1l8ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8ya_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]}
gklpespkraeeiwqqsvigdylarfkndrvkalkamemtwnnmekkeklmwikkaaedq
kryerelsemrappaatnsskkle

SCOPe Domain Coordinates for d1l8ya_:

Click to download the PDB-style file with coordinates for d1l8ya_.
(The format of our PDB-style files is described here.)

Timeline for d1l8ya_: