SCOP 1.61: Domain d1l8pc2: 1l8p C:1001-1141

Lineage for d1l8pc2 (1l8p C:1001-1141)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (8 proteins)

6. Protein Enolase [54828] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (12 PDB entries)

8. Domain d1l8pc2: 1l8p C:1001-1141 [73697]
   Other proteins in same PDB: d1l8pa1, d1l8pb1, d1l8pc1, d1l8pd1

Details for d1l8pc2

PDB Entry: 1l8p, 2.1 Å

PDB Description: mg-phosphonoacetohydroxamate complex of s39a yeast enolase 1

SCOP Domain Sequences for d1l8pc2:

Sequence; same for both SEQRES and ATOM records:

>d1l8pc2 d.54.1.1 (C:1001-1141) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
avskvyarsvydsrgnptvevelttekgvfrsivpsgaatgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

Timeline for d1l8pc2:

• d1l8pc2 is new in SCOP 1.61
  
• d1l8pc2 appears in SCOP 1.63
  
• d1l8pc2 appears in the current release, SCOPe 2.08