Lineage for d1l8pb1 (1l8p B:642-936)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1573508Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1573509Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 1573510Protein Enolase [51606] (9 species)
    Fold of this protein slightly differs from common fold in topology
  7. 1573511Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51607] (16 PDB entries)
  8. 1573528Domain d1l8pb1: 1l8p B:642-936 [73694]
    Other proteins in same PDB: d1l8pa2, d1l8pb2, d1l8pc2, d1l8pd2
    complexed with mg, pah

Details for d1l8pb1

PDB Entry: 1l8p (more details), 2.1 Å

PDB Description: mg-phosphonoacetohydroxamate complex of s39a yeast enolase 1
PDB Compounds: (B:) enolase 1

SCOPe Domain Sequences for d1l8pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8pb1 c.1.11.1 (B:642-936) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkry
gasagnvgdeggvapniqtaeealdlivdaikaaghdgkvkigldcasseffkdgkydld
fknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivadd
ltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedt
fiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl

SCOPe Domain Coordinates for d1l8pb1:

Click to download the PDB-style file with coordinates for d1l8pb1.
(The format of our PDB-style files is described here.)

Timeline for d1l8pb1: