Lineage for d1l8ca_ (1l8c A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2589293Fold g.53: TAZ domain [57932] (1 superfamily)
    all-alpha fold; Zn-binding sites are in the loops connecting helices
  4. 2589294Superfamily g.53.1: TAZ domain [57933] (1 family) (S)
    automatically mapped to Pfam PF02135
  5. 2589295Family g.53.1.1: TAZ domain [57934] (2 proteins)
  6. 2589296Protein CREB-binding transcriptional adaptor protein CBP (p300) [57935] (2 species)
  7. 2589301Species Mouse (Mus musculus) [TaxId:10090] [57936] (6 PDB entries)
  8. 2589304Domain d1l8ca_: 1l8c A: [73685]
    Other proteins in same PDB: d1l8cb_
    TAZ1 domain; complexed with the C-terminal activation domain (CTAD) of human HIF-1alpha (chain B)
    complexed with zn

Details for d1l8ca_

PDB Entry: 1l8c (more details)

PDB Description: structural basis for hif-1alpha/cbp recognition in the cellular hypoxic response
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d1l8ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8ca_ g.53.1.1 (A:) CREB-binding transcriptional adaptor protein CBP (p300) {Mouse (Mus musculus) [TaxId: 10090]}
adpekrkliqqqlvlllhahkcqrreqangevracslphcrtmknvlnhmthcqagkacq
vahcassrqiishwknctrhdcpvclplknasdkr

SCOPe Domain Coordinates for d1l8ca_:

Click to download the PDB-style file with coordinates for d1l8ca_.
(The format of our PDB-style files is described here.)

Timeline for d1l8ca_: