Lineage for d1l7ya_ (1l7y A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1017616Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1018272Family d.15.1.6: BM-002-like [75362] (3 proteins)
    Pfam PF03671; UPF0185; this family comprises small uncharacterized proteins including human protein BM-002
  6. 1018276Protein Hypothetical protein zk652.3 [75363] (1 species)
  7. 1018277Species Nematode (Caenorhabditis elegans) [TaxId:6239] [75364] (1 PDB entry)
  8. 1018278Domain d1l7ya_: 1l7y A: [73676]
    structural genomics

Details for d1l7ya_

PDB Entry: 1l7y (more details)

PDB Description: solution nmr structure of c. elegans protein zk652.3. northeast structural genomics consortium target wr41.
PDB Compounds: (A:) hypothetical protein zk652.3

SCOPe Domain Sequences for d1l7ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l7ya_ d.15.1.6 (A:) Hypothetical protein zk652.3 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
msggtaattagskvtfkitltsdpklpfkvlsvpestpftavlkfaaeefkvpaatsaii
tndgvgvnpaqpagniflkhgselrliprdrvgh

SCOPe Domain Coordinates for d1l7ya_:

Click to download the PDB-style file with coordinates for d1l7ya_.
(The format of our PDB-style files is described here.)

Timeline for d1l7ya_: