SCOP 1.73: Domain d1l7ya_: 1l7y A:

Lineage for d1l7ya_ (1l7y A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (7 families)

5. Family d.15.1.6: BM-002-like [75362] (3 proteins)
   Pfam PF03671; UPF0185; this family comprises small uncharacterized proteins including human protein BM-002

6. Protein Hypothetical protein zk652.3 [75363] (1 species)

7. Species Caenorhabditis elegans [TaxId:6239] [75364] (1 PDB entry)

8. Domain d1l7ya_: 1l7y A: [73676]
   structural genomics

Details for d1l7ya_

PDB Entry: 1l7y

PDB Description: solution nmr structure of c. elegans protein zk652.3. northeast structural genomics consortium target wr41.

PDB Compounds: (A:) hypothetical protein zk652.3

SCOP Domain Sequences for d1l7ya_:

Sequence; same for both SEQRES and ATOM records:

>d1l7ya_ d.15.1.6 (A:) Hypothetical protein zk652.3 {Caenorhabditis elegans [TaxId: 6239]}
msggtaattagskvtfkitltsdpklpfkvlsvpestpftavlkfaaeefkvpaatsaii
tndgvgvnpaqpagniflkhgselrliprdrvgh

Timeline for d1l7ya_:

• d1l7ya_ first appeared in SCOP 1.61
  
• d1l7ya_ appears in SCOP 1.71
  
• d1l7ya_ appears in SCOP 1.75
  
• d1l7ya_ appears in the current release, SCOPe 2.08