Lineage for d1l7ya_ (1l7y A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 598489Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 598741Family d.15.1.6: BM-002-like [75362] (2 proteins)
    Pfam 03671; UPF0185; this family comprises small uncharacterized proteins including human protein BM-002
  6. 598745Protein Hypothetical protein zk652.3 [75363] (1 species)
  7. 598746Species Caenorhabditis elegans [75364] (1 PDB entry)
  8. 598747Domain d1l7ya_: 1l7y A: [73676]
    structural genomics

Details for d1l7ya_

PDB Entry: 1l7y (more details)

PDB Description: solution nmr structure of c. elegans protein zk652.3. northeast structural genomics consortium target wr41.

SCOP Domain Sequences for d1l7ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l7ya_ d.15.1.6 (A:) Hypothetical protein zk652.3 {Caenorhabditis elegans}
msggtaattagskvtfkitltsdpklpfkvlsvpestpftavlkfaaeefkvpaatsaii
tndgvgvnpaqpagniflkhgselrliprdrvgh

SCOP Domain Coordinates for d1l7ya_:

Click to download the PDB-style file with coordinates for d1l7ya_.
(The format of our PDB-style files is described here.)

Timeline for d1l7ya_: