SCOP 1.61: Domain d1l6xa1: 1l6x A:237-341

Lineage for d1l6xa1 (1l6x A:237-341)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fc (human) IgG1 class [49120] (9 PDB entries)

8. Domain d1l6xa1: 1l6x A:237-341 [73642]
   Other proteins in same PDB: d1l6xb_

Details for d1l6xa1

PDB Entry: 1l6x, 1.65 Å

PDB Description: fc fragment of rituximab bound to a minimized version of the b-domain from protein a called z34c

SCOP Domain Sequences for d1l6xa1:

Sequence; same for both SEQRES and ATOM records:

>d1l6xa1 b.1.1.2 (A:237-341) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

Timeline for d1l6xa1:

• d1l6xa1 is new in SCOP 1.61
  
• d1l6xa1 appears in SCOP 1.63
  
• d1l6xa1 appears in the current release, SCOPe 2.08