Lineage for d1l6wd_ (1l6w D:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 817252Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 817253Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 817324Protein Decameric fructose-6-phosphate aldolase/transaldolase [75085] (3 species)
    forms helix-swapped pentamers
  7. 817325Species Escherichia coli [TaxId:562] [75086] (1 PDB entry)
  8. 817329Domain d1l6wd_: 1l6w D: [73635]

Details for d1l6wd_

PDB Entry: 1l6w (more details), 1.93 Å

PDB Description: fructose-6-phosphate aldolase
PDB Compounds: (D:) Fructose-6-phosphate aldolase 1

SCOP Domain Sequences for d1l6wd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6wd_ c.1.10.1 (D:) Decameric fructose-6-phosphate aldolase/transaldolase {Escherichia coli [TaxId: 562]}
melyldtsdvvavkalsrifplagvttnpsiiaagkkpldvvlpqlheamggqgrlfaqv
mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
cesitlpldvaqqmisypavdaavakfeqdwqgafgrtsi

SCOP Domain Coordinates for d1l6wd_:

Click to download the PDB-style file with coordinates for d1l6wd_.
(The format of our PDB-style files is described here.)

Timeline for d1l6wd_: