Lineage for d1l5gb1 (1l5g B:55-106,B:355-434)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1523705Superfamily b.1.15: Integrin domains [69179] (2 families) (S)
  5. 1523706Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 1523707Protein Hybrid domain of integrin beta [69183] (1 species)
  7. 1523708Species Human (Homo sapiens) [TaxId:9606] [69184] (5 PDB entries)
    Uniprot P05106 27-466
  8. 1523713Domain d1l5gb1: 1l5g B:55-106,B:355-434 [73585]
    Other proteins in same PDB: d1l5ga1, d1l5ga2, d1l5ga3, d1l5ga4, d1l5gb2, d1l5gb3, d1l5gb4, d1l5gb5
    complexed with mn, nag

Details for d1l5gb1

PDB Entry: 1l5g (more details), 3.2 Å

PDB Description: crystal structure of the extracellular segment of integrin avb3 in complex with an arg-gly-asp ligand
PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1l5gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5gb1 b.1.15.1 (B:55-106,B:355-434) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]}
efpvsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrd
lpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgf
kdslivqvtfdcd

SCOPe Domain Coordinates for d1l5gb1:

Click to download the PDB-style file with coordinates for d1l5gb1.
(The format of our PDB-style files is described here.)

Timeline for d1l5gb1: