Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.15: Integrin domains [69179] (1 family) |
Family b.1.15.1: Integrin domains [69180] (2 proteins) |
Protein Hybrid domain of integrin beta [69183] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69184] (5 PDB entries) Uniprot P05106 27-466 |
Domain d1l5gb1: 1l5g B:55-106,B:355-434 [73585] Other proteins in same PDB: d1l5ga1, d1l5ga2, d1l5ga3, d1l5ga4, d1l5gb2, d1l5gb3, d1l5gb4, d1l5gb5 complexed with mn, nag |
PDB Entry: 1l5g (more details), 3.2 Å
SCOPe Domain Sequences for d1l5gb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l5gb1 b.1.15.1 (B:55-106,B:355-434) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]} efpvsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrd lpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgf kdslivqvtfdcd
Timeline for d1l5gb1:
View in 3D Domains from same chain: (mouse over for more information) d1l5gb2, d1l5gb3, d1l5gb4, d1l5gb5 |
View in 3D Domains from other chains: (mouse over for more information) d1l5ga1, d1l5ga2, d1l5ga3, d1l5ga4 |