Lineage for d1l3lb2 (1l3l B:2-169)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970915Superfamily d.110.5: Pheromone-binding domain of LuxR-like quorum-sensing transcription factors [75516] (1 family) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3)-alpha; possibly related to the PAS domain
    automatically mapped to Pfam PF03472
  5. 2970916Family d.110.5.1: Pheromone-binding domain of LuxR-like quorum-sensing transcription factors [75517] (1 protein)
  6. 2970917Protein Transcription factor TraR, N-terminal domain [75518] (1 species)
  7. 2970918Species Agrobacterium tumefaciens [TaxId:358] [75519] (2 PDB entries)
  8. 2970920Domain d1l3lb2: 1l3l B:2-169 [73544]
    Other proteins in same PDB: d1l3la1, d1l3lb1, d1l3lc1, d1l3ld1
    protein/DNA complex; complexed with lae

Details for d1l3lb2

PDB Entry: 1l3l (more details), 1.66 Å

PDB Description: crystal structure of a bacterial quorum-sensing transcription factor complexed with pheromone and dna
PDB Compounds: (B:) transcriptional activator protein trar

SCOPe Domain Sequences for d1l3lb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3lb2 d.110.5.1 (B:2-169) Transcription factor TraR, N-terminal domain {Agrobacterium tumefaciens [TaxId: 358]}
qhwldkltdlaaiegdecilktgladiadhfgftgyaylhiqhrhitavtnyhrqwqsty
fdkkfealdpvvkrarsrkhiftwsgeherptlskderafydhasdfgirsgitipikta
ngfmsmftmasdkpvidldreidavaaaatigqiharisflrttptae

SCOPe Domain Coordinates for d1l3lb2:

Click to download the PDB-style file with coordinates for d1l3lb2.
(The format of our PDB-style files is described here.)

Timeline for d1l3lb2: