Lineage for d1l2ae_ (1l2a E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004076Family a.102.1.2: Cellulases catalytic domain [48213] (12 protein domains)
  6. 2004138Protein Processive endocellulase CelF (Cel48F) [48220] (2 species)
  7. 2004149Species Clostridium thermocellum [TaxId:1515] [74765] (2 PDB entries)
  8. 2004160Domain d1l2ae_: 1l2a E: [73497]

Details for d1l2ae_

PDB Entry: 1l2a (more details), 2.5 Å

PDB Description: The Crystal Structure and Catalytic Mechanism of Cellobiohydrolase CelS, the Major Enzymatic Component of the Clostridium thermocellum cellulosome
PDB Compounds: (E:) cellobiohydrolase

SCOPe Domain Sequences for d1l2ae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2ae_ a.102.1.2 (E:) Processive endocellulase CelF (Cel48F) {Clostridium thermocellum [TaxId: 1515]}
gptkaptkdgtsykdlflelygkikdpkngyfspdegipyhsietliveapdyghvttse
afsyyvwleamygnltgnwsgvetawkvmedwiipdsteqpgmssynpnspatyadeyed
psyypselkfdtvrvgsdpvhndlvsaygpnmylmhwlmdvdnwygfgtgtratfintfq
rgeqestwetiphpsieefkyggpngfldlftkdrsyakqwrytnapdaegraiqavywa
nkwakeqgkgsavasvvskaakmgdflrndmfdkyfmkigaqdktpatgydsahylmawy
tawgggigaswawkigcshahfgyqnpfqgwvsatqsdfapkssngkrdwttsykrqlef
yqwlqsaeggiaggatnswngryekypagtstfygmayvphpvyadpgsnqwfgfqawsm
qrvmeyyletgdssvknlikkwvdwvmseiklyddgtfaipsdlewsgqpdtwtgtytgn
pnlhvrvtsygtdlgvagslanalatyaaaterwegkldtkardmaaelvnrawynfycs
egkgvvteearadykrffeqevyvpagwsgtmpngdkiqpgikfidirtkyrqdpyydiv
yqaylrgeapvlnyhrfwhevdlavamgvlatyfpdmtykvp

SCOPe Domain Coordinates for d1l2ae_:

Click to download the PDB-style file with coordinates for d1l2ae_.
(The format of our PDB-style files is described here.)

Timeline for d1l2ae_: