SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1l1ye_ (1l1y E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004076Family a.102.1.2: Cellulases catalytic domain [48213] (12 protein domains)
  6. 2004138Protein Processive endocellulase CelF (Cel48F) [48220] (2 species)
  7. 2004149Species Clostridium thermocellum [TaxId:1515] [74765] (2 PDB entries)
  8. 2004154Domain d1l1ye_: 1l1y E: [73490]

Details for d1l1ye_

PDB Entry: 1l1y (more details), 2.4 Å

PDB Description: The Crystal Structure and Catalytic Mechanism of Cellobiohydrolase CelS, the Major Enzymatic Component of the Clostridium thermocellum cellulosome
PDB Compounds: (E:) cellobiohydrolase

SCOPe Domain Sequences for d1l1ye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1ye_ a.102.1.2 (E:) Processive endocellulase CelF (Cel48F) {Clostridium thermocellum [TaxId: 1515]}
gptkaptkdgtsykdlflelygkikdpkngyfspdegipyhsietliveapdyghvttse
afsyyvwleamygnltgnwsgvetawkvmedwiipdsteqpgmssynpnspatyadeyed
psyypselkfdtvrvgsdpvhndlvsaygpnmylmhwlmdvdnwygfgtgtratfintfq
rgeqestwetiphpsieefkyggpngfldlftkdrsyakqwrytnapdaegraiqavywa
nkwakeqgkgsavasvvskaakmgdflrndmfdkyfmkigaqdktpatgydsahylmawy
tawgggigaswawkigcshahfgyqnpfqgwvsatqsdfapkssngkrdwttsykrqlef
yqwlqsaeggiaggatnswngryekypagtstfygmayvphpvyadpgsnqwfgfqawsm
qrvmeyyletgdssvknlikkwvdwvmseiklyddgtfaipsdlewsgqpdtwtgtytgn
pnlhvrvtsygtdlgvagslanalatyaaaterwegkldtkardmaaelvnrawynfycs
egkgvvteearadykrffeqevyvpagwsgtmpngdkiqpgikfidirtkyrqdpyydiv
yqaylrgeapvlnyhrfwhevdlavamgvlatyfpdmtykvp

SCOPe Domain Coordinates for d1l1ye_:

Click to download the PDB-style file with coordinates for d1l1ye_.
(The format of our PDB-style files is described here.)

Timeline for d1l1ye_: