Lineage for d1l1sa_ (1l1s A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.114: YchN-like [75168] (1 superfamily) Superfamily c.114.1: YchN-like [75169] (1 family) 
Family c.114.1.1: YchN-like [75170] (1 protein) Protein Hypothetical protein MTH1491 [75171] (1 species) Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [75172] (1 PDB entry) 
Domain d1l1sa_: 1l1s A: [73484]
Details for d1l1sa_
PDB Entry: 1l1s (more details), 2.3 Å
PDB Description: structure of protein of unknown function mth1491 from methanobacterium thermoautotrophicum
SCOP Domain Sequences for d1l1sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l1sa_ c.114.1.1 (A:) Hypothetical protein MTH1491 {Archaeon Methanobacterium thermoautotrophicum}
dyrvvfhideddesrvlllisnvrnlmadlesvrievvaysmgvnvlrrdseysgdvsel
tgqgvrfcacsntlrasgmdgddllegvdvvssgvghivrrqtegwayirp
SCOP Domain Coordinates for d1l1sa_:
Click to download the PDB-style file with coordinates for d1l1sa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l1sa_:
- d1l1sa_ is new in SCOP 1.61
- d1l1sa_ appears in SCOP 1.63
- d1l1sa_ appears in the current release, SCOPe 2.08
View in 3D