Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein T-cell antigen receptor [49125] (6 species) |
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries) |
Domain d1l0xa2: 1l0x A:118-244 [73433] Other proteins in same PDB: d1l0xa1, d1l0xb1, d1l0xb2, d1l0xc1, d1l0xd1, d1l0xd2 |
PDB Entry: 1l0x (more details), 2.8 Å
SCOP Domain Sequences for d1l0xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0xa2 b.1.1.2 (A:118-244) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea wgr
Timeline for d1l0xa2: