Lineage for d1l0xa2 (1l0x A:118-244)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 935079Protein T-cell antigen receptor [49125] (6 species)
  7. 935181Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)
  8. 935196Domain d1l0xa2: 1l0x A:118-244 [73433]
    Other proteins in same PDB: d1l0xa1, d1l0xb1, d1l0xb2, d1l0xc1, d1l0xd1, d1l0xd2
    complexed with gol

Details for d1l0xa2

PDB Entry: 1l0x (more details), 2.8 Å

PDB Description: tcr beta chain complexed with streptococcal superantigen spea
PDB Compounds: (A:) 14.3.d T cell receptor beta chain

SCOPe Domain Sequences for d1l0xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0xa2 b.1.1.2 (A:118-244) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgr

SCOPe Domain Coordinates for d1l0xa2:

Click to download the PDB-style file with coordinates for d1l0xa2.
(The format of our PDB-style files is described here.)

Timeline for d1l0xa2: