Lineage for d1l0vp_ (1l0v P:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629948Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2630045Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 2630065Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 2630083Protein Fumarate reductase subunit FrdD [81372] (2 species)
  7. 2630087Species Escherichia coli [TaxId:562] [81371] (6 PDB entries)
    is not known to bind heme
  8. 2630093Domain d1l0vp_: 1l0v P: [73425]
    Other proteins in same PDB: d1l0va1, d1l0va2, d1l0va3, d1l0vb1, d1l0vb2, d1l0vc_, d1l0vm1, d1l0vm2, d1l0vm3, d1l0vn1, d1l0vn2, d1l0vo_
    complexed with ce1, f3s, fad, fes, mq7, oaa, sf4

Details for d1l0vp_

PDB Entry: 1l0v (more details), 3.3 Å

PDB Description: Quinol-Fumarate Reductase with Menaquinol Molecules
PDB Compounds: (P:) fumarate reductase 13 kda hydrophobic protein

SCOPe Domain Sequences for d1l0vp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0vp_ f.21.2.2 (P:) Fumarate reductase subunit FrdD {Escherichia coli [TaxId: 562]}
minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq
sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti

SCOPe Domain Coordinates for d1l0vp_:

Click to download the PDB-style file with coordinates for d1l0vp_.
(The format of our PDB-style files is described here.)

Timeline for d1l0vp_: