Class a: All alpha proteins [46456] (285 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) contains two Fe4-S4 clusters |
Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
Species Escherichia coli [TaxId:562] [46551] (6 PDB entries) |
Domain d1l0vn1: 1l0v N:106-243 [73422] Other proteins in same PDB: d1l0va1, d1l0va2, d1l0va3, d1l0vb2, d1l0vc_, d1l0vd_, d1l0vm1, d1l0vm2, d1l0vm3, d1l0vn2, d1l0vo_, d1l0vp_ complexed with ce1, f3s, fad, fes, mq7, oaa, sf4 |
PDB Entry: 1l0v (more details), 3.3 Å
SCOPe Domain Sequences for d1l0vn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0vn1 a.1.2.1 (N:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq qgkvesskdfliatlkpr
Timeline for d1l0vn1: