Lineage for d1l0fb_ (1l0f B:)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 200057Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
  4. 200058Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 200059Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins)
  6. 200060Protein AMPC beta-Lactamase, class C [56618] (3 species)
  7. 200073Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (24 PDB entries)
  8. 200079Domain d1l0fb_: 1l0f B: [73399]

Details for d1l0fb_

PDB Entry: 1l0f (more details), 1.66 Å

PDB Description: x-ray crystal structure of ampc n152h mutant beta-lactamase

SCOP Domain Sequences for d1l0fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0fb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyahssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOP Domain Coordinates for d1l0fb_:

Click to download the PDB-style file with coordinates for d1l0fb_.
(The format of our PDB-style files is described here.)

Timeline for d1l0fb_: