Class b: All beta proteins [48724] (176 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) |
Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins) |
Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49420] (34 PDB entries) |
Domain d1kzyb_: 1kzy B: [73382] Other proteins in same PDB: d1kzyc1, d1kzyc2, d1kzyd1, d1kzyd2 protein/DNA complex; complexed with zn |
PDB Entry: 1kzy (more details), 2.5 Å
SCOPe Domain Sequences for d1kzyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kzyb_ b.2.5.2 (B:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppg trvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrh svvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrv cacpgrdrrteeenl
Timeline for d1kzyb_: