| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
| Protein Mannose-binding protein A, C-lectin domain [56458] (2 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) |
| Domain d1kzb1_: 1kzb 1: [73346] complexed with ca, man |
PDB Entry: 1kzb (more details), 1.8 Å
SCOPe Domain Sequences for d1kzb1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kzb1_ d.169.1.1 (1:) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvfe
dltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs
Timeline for d1kzb1_: