Lineage for d1kz4c_ (1kz4 C:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240739Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 240740Superfamily c.16.1: Lumazine synthase [52121] (1 family) (S)
  5. 240741Family c.16.1.1: Lumazine synthase [52122] (1 protein)
  6. 240742Protein Lumazine synthase [52123] (7 species)
  7. 240792Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [75151] (7 PDB entries)
  8. 240820Domain d1kz4c_: 1kz4 C: [73325]

Details for d1kz4c_

PDB Entry: 1kz4 (more details), 3.1 Å

PDB Description: mutant enzyme w63y lumazine synthase from s.pombe

SCOP Domain Sequences for d1kz4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kz4c_ c.16.1.1 (C:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe)}
sdlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvpgsyelpqgir
asiarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlneeqa
lyraglngghnhgndwgsaavemglkaly

SCOP Domain Coordinates for d1kz4c_:

Click to download the PDB-style file with coordinates for d1kz4c_.
(The format of our PDB-style files is described here.)

Timeline for d1kz4c_: