Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.16.1: Lumazine synthase [52121] (1 family) |
Family c.16.1.1: Lumazine synthase [52122] (1 protein) |
Protein Lumazine synthase [52123] (7 species) |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [75151] (7 PDB entries) |
Domain d1kz4c_: 1kz4 C: [73325] |
PDB Entry: 1kz4 (more details), 3.1 Å
SCOP Domain Sequences for d1kz4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kz4c_ c.16.1.1 (C:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe)} sdlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvpgsyelpqgir asiarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlneeqa lyraglngghnhgndwgsaavemglkaly
Timeline for d1kz4c_:
View in 3D Domains from other chains: (mouse over for more information) d1kz4a_, d1kz4b_, d1kz4d_, d1kz4e_ |