Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.16.1: Lumazine synthase [52121] (1 family) |
Family c.16.1.1: Lumazine synthase [52122] (1 protein) |
Protein Lumazine synthase [52123] (7 species) |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [75151] (7 PDB entries) |
Domain d1kyxe_: 1kyx E: [73306] complexed with crm, po4 |
PDB Entry: 1kyx (more details), 2.6 Å
SCOP Domain Sequences for d1kyxe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kyxe_ c.16.1.1 (E:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe)} gpnpsdlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvpgswelp qgirasiarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvln eeqalyraglngghnhgndwgsaavemglkal
Timeline for d1kyxe_:
View in 3D Domains from other chains: (mouse over for more information) d1kyxa_, d1kyxb_, d1kyxc_, d1kyxd_ |