SCOP 1.63: Domain d1kyxe_: 1kyx E:

Lineage for d1kyxe_ (1kyx E:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.16: Lumazine synthase [52120] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.16.1: Lumazine synthase [52121] (1 family)

5. Family c.16.1.1: Lumazine synthase [52122] (1 protein)

6. Protein Lumazine synthase [52123] (7 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [75151] (7 PDB entries)

8. Domain d1kyxe_: 1kyx E: [73306]
   complexed with crm, po4

Details for d1kyxe_

PDB Entry: 1kyx, 2.6 Å

PDB Description: Lumazine Synthase from S.pombe bound to carboxyethyllumazine

SCOP Domain Sequences for d1kyxe_:

Sequence; same for both SEQRES and ATOM records:

>d1kyxe_ c.16.1.1 (E:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe)}
gpnpsdlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvpgswelp
qgirasiarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvln
eeqalyraglngghnhgndwgsaavemglkal

Timeline for d1kyxe_:

• d1kyxe_ first appeared in SCOP 1.61
  
• d1kyxe_ appears in SCOP 1.65
  
• d1kyxe_ appears in the current release, SCOPe 2.08