Lineage for d1kyua2 (1kyu A:825-938)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574835Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily)
    beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet
  4. 2574836Superfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families) (S)
  5. 2574837Family d.105.1.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55712] (2 proteins)
  6. 2574838Protein Alpa-adaptin AP2, C-terminal subdomain [55713] (1 species)
  7. 2574839Species Mouse (Mus musculus) [TaxId:10090] [55714] (10 PDB entries)
    Uniprot P17427 694-938 # 98% sequence identity
  8. 2574845Domain d1kyua2: 1kyu A:825-938 [73290]
    Other proteins in same PDB: d1kyua1, d1kyua3

Details for d1kyua2

PDB Entry: 1kyu (more details), 1.8 Å

PDB Description: ap-2 clathrin adaptor alpha-appendage in complex with eps15 dpf peptide
PDB Compounds: (A:) alpha-adaptin c

SCOPe Domain Sequences for d1kyua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyua2 d.105.1.1 (A:825-938) Alpa-adaptin AP2, C-terminal subdomain {Mouse (Mus musculus) [TaxId: 10090]}
ffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiigfgsalleevdpnp
anfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlcellseqf

SCOPe Domain Coordinates for d1kyua2:

Click to download the PDB-style file with coordinates for d1kyua2.
(The format of our PDB-style files is described here.)

Timeline for d1kyua2: