Lineage for d1kysa_ (1kys A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1643322Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1643323Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1643324Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1643328Protein Green fluorescent protein, GFP [54513] (4 species)
  7. 1643334Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (160 PDB entries)
    Uniprot P42212
  8. 1643369Domain d1kysa_: 1kys A: [73288]
    Zn biosensor, Zn-bound form
    complexed with zn

Details for d1kysa_

PDB Entry: 1kys (more details), 1.44 Å

PDB Description: crystal structure of a zn-bound green fluorescent protein biosensor
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d1kysa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kysa_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
lxvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlvnriel
kgidfkedgnilghkleynfnsgnvyitadkqkngikanfkirhniedgsvqladhyqqn
tpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit

SCOPe Domain Coordinates for d1kysa_:

Click to download the PDB-style file with coordinates for d1kysa_.
(The format of our PDB-style files is described here.)

Timeline for d1kysa_: