Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) contains an additional N-terminal strand |
Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins) ear domain consists of two different subdomains automatically mapped to Pfam PF02883 |
Protein Alpha-adaptin AP2 ear domain, N-terminal subdomain [49350] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [49351] (10 PDB entries) Uniprot P17427 694-938 # 98% sequence identity |
Domain d1kyfa1: 1kyf A:701-824 [73220] Other proteins in same PDB: d1kyfa2, d1kyfa3 complexed with eps15 dpf peptide (chain P) |
PDB Entry: 1kyf (more details), 1.22 Å
SCOPe Domain Sequences for d1kyfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kyfa1 b.1.10.1 (A:701-824) Alpha-adaptin AP2 ear domain, N-terminal subdomain {Mouse (Mus musculus) [TaxId: 10090]} sednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqflnftptlicad dlqtnlnlqtkpvdptvdggaqvqqvvniecisdfteapvlniqfryggtfqnvsvklpi tlnk
Timeline for d1kyfa1: