SCOP 1.61: Domain d1ky6a2: 1ky6 A:825-938

Lineage for d1ky6a2 (1ky6 A:825-938)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.105: Clathrin adaptor appendage domain [55710] (1 superfamily)

4. Superfamily d.105.1: Clathrin adaptor appendage domain [55711] (1 family)

5. Family d.105.1.1: Clathrin adaptor appendage domain [55712] (2 proteins)

6. Protein Alpa-adaptin AP2, C-terminal subdomain [55713] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [55714] (8 PDB entries)

8. Domain d1ky6a2: 1ky6 A:825-938 [73195]
   Other proteins in same PDB: d1ky6a1

Details for d1ky6a2

PDB Entry: 1ky6, 2 Å

PDB Description: ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide

SCOP Domain Sequences for d1ky6a2:

Sequence; same for both SEQRES and ATOM records:

>d1ky6a2 d.105.1.1 (A:825-938) Alpa-adaptin AP2, C-terminal subdomain {Mouse (Mus musculus)}
ffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiigfgsalleevdpnp
anfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlcellseqf

Timeline for d1ky6a2:

• d1ky6a2 is new in SCOP 1.61
  
• d1ky6a2 appears in SCOP 1.63
  
• d1ky6a2 appears in the current release, SCOPe 2.08