Lineage for d1kxva1 (1kxv A:404-496)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1555652Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1555653Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1555654Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1555683Protein Animal alpha-amylase [51024] (3 species)
  7. 1555732Species Pig (Sus scrofa) [TaxId:9823] [51025] (13 PDB entries)
  8. 1555738Domain d1kxva1: 1kxv A:404-496 [73186]
    Other proteins in same PDB: d1kxva2, d1kxvb2, d1kxvc_, d1kxvd_

Details for d1kxva1

PDB Entry: 1kxv (more details), 1.6 Å

PDB Description: Camelid VHH Domains in Complex with Porcine Pancreatic alpha-Amylase
PDB Compounds: (A:) alpha-amylase, pancreatic

SCOPe Domain Sequences for d1kxva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxva1 b.71.1.1 (A:404-496) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

SCOPe Domain Coordinates for d1kxva1:

Click to download the PDB-style file with coordinates for d1kxva1.
(The format of our PDB-style files is described here.)

Timeline for d1kxva1: