Lineage for d1kxtb_ (1kxt B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450784Protein Camelid IG heavy chain variable domain, VHh [88563] (2 species)
  7. 450785Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (13 PDB entries)
  8. 450799Domain d1kxtb_: 1kxt B: [73179]
    Other proteins in same PDB: d1kxta1, d1kxta2, d1kxtc1, d1kxtc2, d1kxte1, d1kxte2

Details for d1kxtb_

PDB Entry: 1kxt (more details), 2 Å

PDB Description: Camelid VHH Domains in Complex with Porcine Pancreatic alpha-Amylase

SCOP Domain Sequences for d1kxtb_:

Sequence, based on SEQRES records: (download)

>d1kxtb_ b.1.1.1 (B:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius)}
qvqlvasgggsvqaggslrlscaasgytfssypmgwyrqapgkecelsarifsdgsanya
dsvkgrftisrdnaantaylqmdslkpedtavyycaagpgsgklvvagrtcygpnywgqg
tqvtv

Sequence, based on observed residues (ATOM records): (download)

>d1kxtb_ b.1.1.1 (B:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius)}
qvqlvasgggsvqaggslrlscaastfssypmgwyrqapgkecelsarifsdgsanyads
vkgrftisrdnaantaylqmdslkpedtavyycaagpgsgklvvagrtcygpnywgqgtq
vtv

SCOP Domain Coordinates for d1kxtb_:

Click to download the PDB-style file with coordinates for d1kxtb_.
(The format of our PDB-style files is described here.)

Timeline for d1kxtb_: