Lineage for d1kxpa1 (1kxp A:4-146)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372366Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1372367Protein Actin [53073] (7 species)
  7. 1372393Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (56 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 1372452Domain d1kxpa1: 1kxp A:4-146 [73158]
    Other proteins in same PDB: d1kxpd1, d1kxpd2, d1kxpd3
    complexed with atp, mg

Details for d1kxpa1

PDB Entry: 1kxp (more details), 2.1 Å

PDB Description: crystal structure of human vitamin d-binding protein in complex with skeletal actin
PDB Compounds: (A:) actin,alpha skeletal muscle

SCOPe Domain Sequences for d1kxpa1:

Sequence, based on SEQRES records: (download)

>d1kxpa1 c.55.1.1 (A:4-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim
fetfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d1kxpa1 c.55.1.1 (A:4-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ettalvcdngsglvkagfagddapravfpsivgrprsyvgdeaqskrgiltlkypiehgi
itnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyva
iqavlslyasg

SCOPe Domain Coordinates for d1kxpa1:

Click to download the PDB-style file with coordinates for d1kxpa1.
(The format of our PDB-style files is described here.)

Timeline for d1kxpa1: