Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (5 families) conserved positions of the oxyanion hole and catalytic nucleophile; different costituent families contain different additional structures |
Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (5 proteins) contains a catalytic Cys-His-Glu triad |
Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species) |
Species Thermotoga maritima [TaxId:243274] [69448] (3 PDB entries) |
Domain d1kxja_: 1kxj A: [73153] |
PDB Entry: 1kxj (more details), 2.8 Å
SCOP Domain Sequences for d1kxja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kxja_ c.23.16.1 (A:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima} ghmrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegm rrlrendlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrl phmgwnevifkdtfpngyyyfvhtyravceeehvlgtteydgeifpsavrkgrilgfqfh peksskigrkllekviecslsrr
Timeline for d1kxja_: