| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
| Protein Mannose-binding protein A, C-lectin domain [56458] (2 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) |
| Domain d1kx1b1: 1kx1 B:105-221 [73135] Other proteins in same PDB: d1kx1a2, d1kx1b2, d1kx1c2, d1kx1d2, d1kx1e2, d1kx1f2 complexed with ca, man |
PDB Entry: 1kx1 (more details), 2.8 Å
SCOPe Domain Sequences for d1kx1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kx1b1 d.169.1.1 (B:105-221) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa
Timeline for d1kx1b1: