| Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (18 proteins) |
| Protein Mannose-binding protein A, lectin domain [56458] (2 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) |
| Domain d1kx0c1: 1kx0 C:105-221 [73131] Other proteins in same PDB: d1kx0a2, d1kx0b2, d1kx0c2 |
PDB Entry: 1kx0 (more details), 2 Å
SCOP Domain Sequences for d1kx0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kx0c1 d.169.1.1 (C:105-221) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndvgsgedcvtivdnglwndvscqashtavcefpa
Timeline for d1kx0c1:
View in 3DDomains from other chains: (mouse over for more information) d1kx0a1, d1kx0a2, d1kx0b1, d1kx0b2 |