| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) | 
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold  | 
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]()  | 
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059  | 
| Protein Mannose-binding protein A, C-lectin domain [56458] (2 species) | 
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) | 
| Domain d1kx0a1: 1kx0 A:105-221 [73127] Other proteins in same PDB: d1kx0a2, d1kx0b2, d1kx0c2 complexed with ca, cl  | 
PDB Entry: 1kx0 (more details), 2 Å
SCOPe Domain Sequences for d1kx0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kx0a1 d.169.1.1 (A:105-221) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndvgsgedcvtivdnglwndvscqashtavcefpa
Timeline for d1kx0a1:
 View in 3DDomains from other chains: (mouse over for more information) d1kx0b1, d1kx0b2, d1kx0c1, d1kx0c2  |