Lineage for d1kwya1 (1kwy A:105-221)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940569Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1940570Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1940571Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1940727Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)
  7. 1940730Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 1940788Domain d1kwya1: 1kwy A:105-221 [73115]
    Other proteins in same PDB: d1kwya2, d1kwyb2, d1kwyc2
    complexed with ca, cl

Details for d1kwya1

PDB Entry: 1kwy (more details), 2 Å

PDB Description: rat mannose protein a complexed with man-a13-man.
PDB Compounds: (A:) mannose-binding protein a

SCOPe Domain Sequences for d1kwya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kwya1 d.169.1.1 (A:105-221) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa

SCOPe Domain Coordinates for d1kwya1:

Click to download the PDB-style file with coordinates for d1kwya1.
(The format of our PDB-style files is described here.)

Timeline for d1kwya1: