Lineage for d1kwwc1 (1kww C:105-221)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1226319Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1226320Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1226321Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1226429Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)
  7. 1226432Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 1226452Domain d1kwwc1: 1kww C:105-221 [73107]
    Other proteins in same PDB: d1kwwa2, d1kwwb2, d1kwwc2
    complexed with ca, cl, mfu

Details for d1kwwc1

PDB Entry: 1kww (more details), 1.9 Å

PDB Description: rat mannose protein a complexed with a-me-fuc.
PDB Compounds: (C:) mannose-binding protein a

SCOPe Domain Sequences for d1kwwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kwwc1 d.169.1.1 (C:105-221) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa

SCOPe Domain Coordinates for d1kwwc1:

Click to download the PDB-style file with coordinates for d1kwwc1.
(The format of our PDB-style files is described here.)

Timeline for d1kwwc1: