Lineage for d1kwuc1 (1kwu C:105-221)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2234639Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2234795Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)
  7. 2234798Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 2234852Domain d1kwuc1: 1kwu C:105-221 [73095]
    Other proteins in same PDB: d1kwua2, d1kwub2, d1kwuc2
    complexed with ca, cl, mma

Details for d1kwuc1

PDB Entry: 1kwu (more details), 1.95 Å

PDB Description: rat mannose binding protein a complexed with a-me-man
PDB Compounds: (C:) mannose-binding protein a

SCOPe Domain Sequences for d1kwuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kwuc1 d.169.1.1 (C:105-221) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa

SCOPe Domain Coordinates for d1kwuc1:

Click to download the PDB-style file with coordinates for d1kwuc1.
(The format of our PDB-style files is described here.)

Timeline for d1kwuc1: