|  | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) | 
|  | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold | 
|  | Superfamily d.169.1: C-type lectin-like [56436] (9 families)  | 
|  | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 | 
|  | Protein Mannose-binding protein A, C-lectin domain [56458] (2 species) | 
|  | Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) | 
|  | Domain d1kwtc1: 1kwt C:105-221 [73089] Other proteins in same PDB: d1kwta2, d1kwtb2, d1kwtc2 complexed with ca, cl | 
PDB Entry: 1kwt (more details), 1.95 Å
SCOPe Domain Sequences for d1kwtc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kwtc1 d.169.1.1 (C:105-221) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa
Timeline for d1kwtc1:
|  View in 3D Domains from other chains: (mouse over for more information) d1kwta1, d1kwta2, d1kwtb1, d1kwtb2 |