SCOP 1.75: Domain d1kwma2: 1kwm A:1A-95A

Lineage for d1kwma2 (1kwm A:1A-95A)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.3: Protease propeptides/inhibitors [54897] (3 families)

5. Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins)

6. Protein Procarboxypeptidase B [54903] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75430] (1 PDB entry)

8. Domain d1kwma2: 1kwm A:1A-95A [73080]
   Other proteins in same PDB: d1kwma1, d1kwmb1

Details for d1kwma2

PDB Entry: 1kwm, 1.6 Å

PDB Description: Human procarboxypeptidase B: Three-dimensional structure and implications for thrombin-activatable fibrinolysis inhibitor (TAFI)

PDB Compounds: (A:) Procarboxypeptidase B

SCOP Domain Sequences for d1kwma2:

Sequence; same for both SEQRES and ATOM records:

>d1kwma2 d.58.3.1 (A:1A-95A) Procarboxypeptidase B {Human (Homo sapiens) [TaxId: 9606]}
hhggehfegekvfrvnvedenhiniirelasttqidfwkpdsvtqikphstvdfrvkaed
tvtvenvlkqnelqykvlisnlrnvveaqfdsrvr

Timeline for d1kwma2:

• d1kwma2 first appeared in SCOP 1.61
  
• d1kwma2 appears in SCOP 1.73
  
• d1kwma2 appears in SCOPe 2.01
  
• d1kwma2 appears in the current release, SCOPe 2.08