Lineage for d1kwma2 (1kwm A:1A-95A)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192127Superfamily d.58.3: Protease propeptides/inhibitors [54897] (3 families) (S)
  5. 192128Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins)
  6. 192138Protein Procarboxypeptidase B [54903] (2 species)
  7. 192139Species Human (Homo sapiens) [TaxId:9606] [75430] (1 PDB entry)
  8. 192140Domain d1kwma2: 1kwm A:1A-95A [73080]
    Other proteins in same PDB: d1kwma1, d1kwmb1

Details for d1kwma2

PDB Entry: 1kwm (more details), 1.6 Å

PDB Description: Human procarboxypeptidase B: Three-dimensional structure and implications for thrombin-activatable fibrinolysis inhibitor (TAFI)

SCOP Domain Sequences for d1kwma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kwma2 d.58.3.1 (A:1A-95A) Procarboxypeptidase B {Human (Homo sapiens)}
hhggehfegekvfrvnvedenhiniirelasttqidfwkpdsvtqikphstvdfrvkaed
tvtvenvlkqnelqykvlisnlrnvveaqfdsrvr

SCOP Domain Coordinates for d1kwma2:

Click to download the PDB-style file with coordinates for d1kwma2.
(The format of our PDB-style files is described here.)

Timeline for d1kwma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kwma1