Lineage for d1kw2a3 (1kw2 A:405-474)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217643Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulphide-linked subdomains
  4. 217644Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 217645Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 217717Protein Vitamin D binding protein [69111] (1 species)
    domain 3 lacks the last subdomain
  7. 217718Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)
  8. 217724Domain d1kw2a3: 1kw2 A:405-474 [73073]

Details for d1kw2a3

PDB Entry: 1kw2 (more details), 2.15 Å

PDB Description: crystal structure of uncomplexed vitamin d-binding protein

SCOP Domain Sequences for d1kw2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kw2a3 a.126.1.1 (A:405-474) Vitamin D binding protein {Human (Homo sapiens)}
elcadysentfteykkklaerlkaklpdatpkelaklvnkrsdfasnccsinspplycds
eidaelknil

SCOP Domain Coordinates for d1kw2a3:

Click to download the PDB-style file with coordinates for d1kw2a3.
(The format of our PDB-style files is described here.)

Timeline for d1kw2a3: