![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) ![]() |
![]() | Family d.92.1.9: Hemorrhagin [55519] (1 protein) |
![]() | Protein Snake venom metalloprotease [55520] (5 species) |
![]() | Species Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId:103944] [75495] (4 PDB entries) |
![]() | Domain d1kuia_: 1kui A: [73009] complexed with cd |
PDB Entry: 1kui (more details), 1.5 Å
SCOP Domain Sequences for d1kuia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kuia_ d.92.1.9 (A:) Snake venom metalloprotease {Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E} qrfpqryielaivvdhgmytkyssnfkkirkrvhqmvsninemcrplniaitlalldvws ekdfitvqadapttaglfgdwrervllkkknhdhaqlltdtnfarntigwayvgrmcdek ysvavvkdhsskvfmvavtmthelghnlgmehddkdkckcdtcimsavisdkqsklfsdc skdyyqtfltndnpqcilnap
Timeline for d1kuia_: