Lineage for d1kuia_ (1kui A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259924Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 259925Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 260064Family d.92.1.9: Hemorrhagin [55519] (1 protein)
  6. 260065Protein Snake venom metalloprotease [55520] (5 species)
  7. 260076Species Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId:103944] [75495] (4 PDB entries)
  8. 260080Domain d1kuia_: 1kui A: [73009]
    complexed with cd

Details for d1kuia_

PDB Entry: 1kui (more details), 1.5 Å

PDB Description: crystal structure of a taiwan habu venom metalloproteinase complexed with peqw.

SCOP Domain Sequences for d1kuia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kuia_ d.92.1.9 (A:) Snake venom metalloprotease {Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E}
qrfpqryielaivvdhgmytkyssnfkkirkrvhqmvsninemcrplniaitlalldvws
ekdfitvqadapttaglfgdwrervllkkknhdhaqlltdtnfarntigwayvgrmcdek
ysvavvkdhsskvfmvavtmthelghnlgmehddkdkckcdtcimsavisdkqsklfsdc
skdyyqtfltndnpqcilnap

SCOP Domain Coordinates for d1kuia_:

Click to download the PDB-style file with coordinates for d1kuia_.
(The format of our PDB-style files is described here.)

Timeline for d1kuia_: