Lineage for d1ku7a_ (1ku7 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1723765Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 1723798Family a.4.13.2: Sigma4 domain [88665] (5 proteins)
  6. 1723806Protein Sigma70 (SigA, RpoD) [88666] (4 species)
  7. 1723812Species Thermus aquaticus [TaxId:271] [88669] (3 PDB entries)
  8. 1723815Domain d1ku7a_: 1ku7 A: [73001]
    sigma4 domain only
    protein/DNA complex; protein/RNA complex

Details for d1ku7a_

PDB Entry: 1ku7 (more details), 2.4 Å

PDB Description: crystal structure of thermus aquatics rna polymerase sigmaa subunit region 4 bound to-35 element dna
PDB Compounds: (A:) sigma factor sigA

SCOPe Domain Sequences for d1ku7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ku7a_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 271]}
seelekalsklsereamvlkmrkglidgrehtleevgayfgvtrerirqienkalrklky
hesrtrklrdfle

SCOPe Domain Coordinates for d1ku7a_:

Click to download the PDB-style file with coordinates for d1ku7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ku7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ku7d_