| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) ![]() |
| Family a.4.13.2: Sigma4 domain [88665] (5 proteins) |
| Protein Sigma70 (SigA, RpoD) [88666] (4 species) |
| Species Thermus aquaticus [TaxId:271] [88669] (3 PDB entries) |
| Domain d1ku7a_: 1ku7 A: [73001] sigma4 domain only protein/DNA complex; protein/RNA complex |
PDB Entry: 1ku7 (more details), 2.4 Å
SCOPe Domain Sequences for d1ku7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ku7a_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 271]}
seelekalsklsereamvlkmrkglidgrehtleevgayfgvtrerirqienkalrklky
hesrtrklrdfle
Timeline for d1ku7a_: