Lineage for d1ktna_ (1ktn A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1571860Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1571861Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1571958Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species)
  7. 1571965Species Escherichia coli [TaxId:562] [69395] (4 PDB entries)
    Uniprot P00882
  8. 1571972Domain d1ktna_: 1ktn A: [72988]

Details for d1ktna_

PDB Entry: 1ktn (more details), 1.4 Å

PDB Description: structural genomics, protein ec1535
PDB Compounds: (A:) 2-deoxyribose-5-phosphate aldolase

SCOPe Domain Sequences for d1ktna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktna_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]}
mtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarktl
keqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgfd
lvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatpe
sarimmevirdmgvektvgfkpaggvrtaedaqkylaiadelfgadwadarhyrfgassl
lasllkalgh

SCOPe Domain Coordinates for d1ktna_:

Click to download the PDB-style file with coordinates for d1ktna_.
(The format of our PDB-style files is described here.)

Timeline for d1ktna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ktnb_